Tag Results

View Download

A Taverna Users Guide

Created: 2008-08-04 17:40:21

Credits: Paul Fisher Katy Wolstencroft Franck Tanoh

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: PowerPoint presentation

Comments: 0 | Viewed: 160 times | Downloaded: 174 times

View Download

LIFEsparks biotechnology network

Created: 2008-10-19 11:05:10 | Last updated: 2008-10-19 11:12:58

Credits: Suza Adam

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: JPEG image

Comments: 0 | Viewed: 139 times | Downloaded: 73 times

View Download

Popfly Blocks for Protein Characteristics and Predic...

Created: 2008-11-27 10:20:35 | Last updated: 2008-12-01 07:11:27

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 105 times | Downloaded: 49 times

View Download

Popfly Blocks for Protein Characteristics and Predic...

Created: 2008-11-27 10:18:47 | Last updated: 2008-12-01 07:12:41

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 77 times | Downloaded: 41 times

View Download

Popfly Blocks for Protein Characteristics and Predic...

Created: 2008-11-27 10:17:41 | Last updated: 2008-12-01 07:13:40

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 81 times | Downloaded: 45 times

View Download

Popfly Blocks for Protein Characteristics Mashup 1

Created: 2008-11-27 10:11:14 | Last updated: 2008-12-01 07:14:32

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 81 times | Downloaded: 49 times

View Download

Popfly Blocks for Protein Prediction Mashup 1

Created: 2008-11-27 10:13:29 | Last updated: 2008-12-01 07:15:28

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 78 times | Downloaded: 50 times

View Download

Popfly Blocks for Protein Prediction Mashup 2

Created: 2008-11-27 10:15:10 | Last updated: 2008-12-01 07:16:18

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 81 times | Downloaded: 42 times

View Download

Protein Analysis Popfly Blocks

Created: 2008-11-27 10:03:04 | Last updated: 2008-12-01 07:17:33

Credits: Felicity

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: ZIP archive

Comments: 0 | Viewed: 91 times | Downloaded: 52 times

View Download

The general plan and guidelines for BioAssist from O...

Created: 2009-10-26 10:15:03

Credits: Barend

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: application/x-download

Comments: 0 | Viewed: 74 times | Downloaded: 48 times

View Download

ProStack Screencast: Segmentation of Images of Gene ...

Created: 2010-05-20 19:48:40

Credits: Konstantin Kozlov

License: Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 Unported License

File type: AVI video

Comments: 0 | Viewed: 64 times | Downloaded: 26 times

View Download

BLASTP Analysis Pipeline Script

Created: 2024-12-17 12:23:59 | Last updated: 2024-12-17 12:32:28

Credits: George Kargas

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: text/x-python

Comments: 0 | Viewed: 14 times | Downloaded: 8 times

View Download

Batch Phobius Analysis for Protein Sequences

Created: 2024-12-17 12:26:51

Credits: George Kargas

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: text/x-python

Comments: 0 | Viewed: 16 times | Downloaded: 8 times

View Download

Batch Predict_Property Analysis for Protein Sequences

Created: 2024-12-17 12:29:43

Credits: George Kargas

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: text/x-python

Comments: 0 | Viewed: 17 times | Downloaded: 12 times

View Download

Meme parser

Created: 2024-12-18 01:11:45 | Last updated: 2025-01-27 08:10:31

Credits: George Kargas

License: Creative Commons Attribution-Share Alike 3.0 Unported License

File type: Trident (Package)

Comments: 0 | Viewed: 13 times | Downloaded: 10 times

View

metabolomics

Created: Thursday 29 November 2007 11:50:47 (UTC)

3 shared items   |   0 announcements

View

Biomoby

Unique name: biomoby
Created: Tuesday 04 December 2007 09:48:10 (UTC)

0 shared items   |   0 announcements

View

BioAssist_NL

Unique name: bioassist_nl
Created: Wednesday 01 August 2007 13:05:51 (UTC)

4 shared items   |   0 announcements

View

SyMBA: Systems and Molecular Biology Data ...

Unique name: symba
Created: Wednesday 12 September 2007 11:30:41 (UTC)

0 shared items   |   0 announcements

View

e-(bio)science tool group

Created: Tuesday 03 June 2008 09:46:58 (UTC)

3 shared items   |   0 announcements

View

CWA users

Unique name: CWA_Users
Created: Tuesday 01 September 2009 16:35:48 (UTC)

1 shared item   |   0 announcements

View

NBIC Central Engineering Team

Unique name: c
Created: Friday 11 September 2009 08:21:17 (UTC)

1 shared item   |   0 announcements

View

Baywatch Solutions

Unique name: teambncl
Created: Wednesday 10 March 2010 18:39:50 (UTC)

10 shared items   |   1 announcements

View

Bioclipse

Unique name: bioclipse
Created: Monday 13 September 2010 10:29:24 (UTC)

5 shared items   |   0 announcements

View

Bonn eScience Workshop

Created: Wednesday 16 March 2011 10:43:40 (UTC)

32 shared items   |   0 announcements

View

Bonn workshop 2012

Created: Wednesday 29 August 2012 11:39:39 (UTC)

19 shared items   |   0 announcements

View

Gibas Lab

Unique name: gibas-lab
Created: Friday 26 July 2013 15:38:24 (UTC)

3 shared items   |   0 announcements

View

bioKepler

Unique name: bioKepler
Created: Tuesday 01 October 2013 21:46:39 (UTC)

0 shared items   |   0 announcements

View

BioSemantics

Unique name: biosemantics
Created: Thursday 30 June 2011 13:06:48 (UTC)

70 shared items   |   0 announcements

View

FunCUT package

Created: 2008-10-03 16:47:15 | Last updated: 2008-10-03 16:48:55

1 item in this pack

Comments: 0 | Viewed: 166 times | Downloaded: 0 times

View Download

Open Data: Bilateral Perisylvian Polymicrogyria

Created: 2010-11-16 16:20:43 | Last updated: 2011-09-23 10:55:08

7 items in this pack

Comments: 0 | Viewed: 287 times | Downloaded: 50 times

View Download

Natural product likeness filter

Created: 2011-05-13 19:35:39 | Last updated: 2011-08-29 14:25:47

3 items in this pack

Comments: 0 | Viewed: 219 times | Downloaded: 97 times

View Download

Extract Gene Sequence Information with Kepler

Created: 2011-10-05 04:58:33 | Last updated: 2011-10-05 06:11:56

5 items in this pack

Comments: 0 | Viewed: 48 times | Downloaded: 20 times

View

wf4ever Deliverable 6.3 Pack

Created: 2011-12-02 09:31:26 | Last updated: 2011-12-02 10:21:03

6 items in this pack

Comments: 0 | Viewed: 98 times | Downloaded: 0 times

EBI InterProScan (2)

• Download

EBI InterProScan. Stop fannying around with BLAST and use InterProScan instead.

Created: 2007-10-03

Genome annotation pipeline demonstrator wo... (2)

• Download

Part of a workflow by Hannah Tipney, adapted by Duncan Hull using GenScan, RepeatMasker and BLAST. http://dx.doi.org/10.1093/nar/gkl320

Created: 2007-10-03

BLASTP with simplified results returned (2)

• Download

Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...

Created: 2007-10-03 | Last updated: 2009-12-03

Simplify a BLAST text file (2)

• Download

This workflow simplifies a BLAST text file into identifiers, descriptions and values (P, E-values). In order to extract the relevant ids etc. you need to pass the relevant string into the corresponding port, e.g. the default port being used is gi. This has been passed "gi". For any other ports simply pass in the string the SAME as the port name, e.g. seq_id, p, per etc.

Created: 2007-10-03 | Last updated: 2009-07-28

BLAST using DDBJ service (2)

• Download

Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY GDVLRAVEKAATRHSLGLP...

Created: 2007-10-03 | Last updated: 2009-12-03

BLASTP with simplified results returned (2)

• Download

This workflow Performs a blastp search on protein sequence, extracts sequence id within the blast report and retrives the corresponding seuqences.

Created: 2007-10-03 | Last updated: 2008-03-06

EBI NCBI Blast (2)

• Download

EBI NCBI Blast

Created: 2007-10-03

Example of a conditional execution workflow (2)

• Download

If the input is true the workflow returns the temperature in Celsius, if false the temperature in Fahrenheit is returned.

Created: 2007-10-03 | Last updated: 2008-01-27

Multiple Blastp (2)

• Download

This is a workflow to automate multiple BLASTp jobs on a large list of protein sequences in FASTA format.

Created: 2007-11-20 | Last updated: 2008-01-10

Credits: Kieren Lythgow

DataBiNS - Data Mining Workflow for Biolog... (2)

• Download

No description

Created: 2007-12-04 | Last updated: 2007-12-04

Credits: Fong Chun Chan

BiomartAndEMBOSSAnalysis (4)

• Download

Using Biomart and EMBOSS soaplab services, This workflow retrieves a number of sequences from 3 species: mouse, human, rat; align them, and returns a plot of the alignment result. Corresponding sequence ids are also returned.

Created: 2009-09-15 | Last updated: 2015-01-26

Fetch Dragon images from BioMoby (3)

• Download

Fetch images and annotations of snapdragons

Created: 2008-03-05 | Last updated: 2010-07-14

Credits: Tomoinn

Retrieve sequence in EMBL format (3)

• Download

This workflow retrieves a sequence associated with its features in embl format

Created: 2009-06-17

Credits: Franck Tanoh Tomoinn Stuart Owen

Fetch PDB flatfile from RCSB server (1)

• Download

Given an identifier such as '1crn' fetches the PDB format flatfile and returns the corresponding 3D image of the protein.

Created: 2008-03-05 | Last updated: 2008-03-31

Credits: Tomoinn

GBSeq test (2)

• Download

This workflow retrieves nucleotide and protein sequences with the literature and references associated to them given a protein and a nucleotide id.

Created: 2008-03-05 | Last updated: 2008-03-31

Credits: Franck Tanoh

EBI_InterProScan (3)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Perform an InterProScan ...

Created: 2008-10-26 | Last updated: 2011-04-01

Credits: Hamish McWilliam

EBI_InterProScan_with_prompts (1)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Run an InterProScan anal...

Created: 2008-05-31 | Last updated: 2011-04-01

Credits: Hamish McWilliam

Attributions: EBI_InterProScan

EBI_ClustalW2_phylogentic_tree (2)

• Download

Create a Neighbor-joining phylogenetic tree, with Kimura distance corrections, from a sequence alignment using the EBI's WSClustalW2 service (see http://www.ebi.ac.uk/Tools/webservices/services/clustalw2).

Created: 2009-04-07

Credits: Hamish McWilliam

EBI_ClustalW_alignment_tree (2)

• Download

Given a set of sequences perform an multiple sequence alignment and from the multiple alignment derive a phylogenetic tree. The popular ClustalW program (see http://www.clustal.org/), as implemented in the EBI's WSClustalW2 service (see http://www.ebi.ac.uk/Tools/webservices/services/clustalw2) is used to perform both tasks.

Created: 2008-05-31 | Last updated: 2010-12-03

Credits: Hamish McWilliam

Attributions: EBI_ClustalW2 EBI_ClustalW2_phylogentic_tree

EBI_blastpgp_PSI-BLAST (1)

• Download

Perform a PSI-BLAST iterative search using the EBI’s WSBlastpgp service (see http://www.ebi.ac.uk/Tools/webservices/services/blastpgp). The query sequence, database to search and users e-mail address are inputs, the other parameters for the search (see Job_params) are allowed to default. In most cases you will probably want to adjust the expectation thresholds and the maximum number of iterations for your specific query sequence and the database being searched.

Created: 2008-05-31

Credits: Hamish McWilliam

EBI_dbfetch_fetchBatch (1)

• Download

From a list of sequence entry identifiers and a database name, fetch the sequences in fasta format using EBI's WSDbfetch service (see http://www.ebi.ac.uk/Tools/webservices/wsdl/WSDbfetch.wsdl).

Created: 2008-05-31

Credits: Hamish McWilliam

Protein_search_fetch_align_tree (2)

• Download

An implmentation of the classical sequence analysis workflow: Find homologues (sequence similarity search) Fetch homologues Align homologues (multiple sequence alignment) Produce phylogenetic tree In this implementation the EBI webservices are used: WU-BLAST (WSWUBlast) blastp vs. UniProtKB dbfetch (WSDbfetch) ClustalW (WSClustalW2) ClustalW (WSClustalW2) Note: this version does not add the inital query sequence to the alignment, and so is most useful when used with the identifers...

Created: 2009-04-07

Credits: Hamish McWilliam

Attributions: EBI_ClustalW2 EBI_ClustalW2_phylogentic_tree EBI_dbfetch_fetchBatch EBI_WU-BLAST

EBI_Phobius (2)

• Download

The Phobius tool predicts transmembrane domains and signal peptide region from a protein sequence. This workflow uses the EBI's WSPhobius web service (see http://www.ebi.ac.uk/Tools/webservices/services/phobius) to access the tool. The predicted features are returned in a UniProtKB style feature listing.

Created: 2008-06-01 | Last updated: 2008-06-02

Credits: Hamish McWilliam

EBI_InterProScan_tmhmm_signalp (4)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Use the TMHMM and Signal...

Created: 2008-10-26 | Last updated: 2011-04-01

Credits: Hamish McWilliam

Attributions: EBI_InterProScan

Protein_alignment_transmembrane (1)

• Download

Transmembrane domain prediction using EMBOSS tmap with an input sequence alignment of homolouges: Sequence similarity search (SSS) to find homologues Fetch sequences of hits Multiple sequence alignment (MSA) of hit sequences EMBOSS tmap with alignment from 3. Uses the EBI web services: WSFasta (see http://www.ebi.ac.uk/Tools/webservices/services/fasta) WSDbfetch (see http://www.ebi.ac.uk/Tools/webservices/services/dbfetch) WSClustalW2 (see http://www.ebi.ac.uk/Tools/webservices/servic...

Created: 2008-06-01

Credits: Hamish McWilliam

Attributions: EBI_FASTA EBI_ClustalW2 EBI_dbfetch_fetchBatch

Sequence_or_ID (1)

• Download

Given a sequence or sequence entry identifer (e.g. uniprot:wap_rat), return the sequence in fasta format. If a sequence identifier, in database:identifier format, is input the EBI's WSDbfetch web service (see http://www.ebi.ac.uk/Tools/webservices/services/dbfetch) is used to retrive the sequence in fasta format. Otherwise the input is assumed to be a sequence and if passed through the Soaplab EMBOSS seqret service to force the sequence into fasta format.

Created: 2008-06-01

Credits: Hamish McWilliam

tmap_single_sequence (2)

• Download

Simple workflow using tmap to find transmembrane regions, using a single sequence as input.

Created: 2008-06-01 | Last updated: 2008-06-02

Credits: Hamish McWilliam

Attributions: Sequence_or_ID

Protein_transmembrane_prediction (2)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Transmembrane and signal...

Created: 2008-10-26 | Last updated: 2011-04-01

Credits: Hamish McWilliam

Attributions: EBI_InterProScan_tmhmm_signalp EBI_Phobius tmap_single_sequence

EBI_ClustalW2 (2)

• Download

Perform a ClustalW multiple sequence alignment using the EBI’s WSClustalW2 service (see http://www.ebi.ac.uk/Tools/webservices/services/clustalw2). The set of sequences to align are the input, the other parameters for the search (see Job_params) are allowed to default. Note: the WSClustalW2 service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement ClustalW2 servi...

Created: 2009-04-07 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_Kalign (1)

• Download

Multiple sequence alignment using the Kalign tool. This workflow uses the EBI's WSKalign service (see http://www.ebi.ac.uk/Tools/webservices/services/kalign) to access the Kalign tool. The set of sequences to align and the molecule type (protein or nucleic acid) are the input, the other parameters for the search (see Job_params) are allowed to default. Note: the WSKalign service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. Thi...

Created: 2008-06-02 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_WU-BLAST (1)

• Download

Perform a BLAST search using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). The default parameters search UniProtKB using blastp. To change the job parameters see Job_params. Note: the WSWUBlast service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement WU-BLAST services (REST or SOAP) should be used instead.  

Created: 2008-05-30 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI WU-BLAST with program and database sel... (3)

• Download

Run a BLAST analysis using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). This workflow wraps the EBI_WU-BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default. The values presented in the selection menus for the program and database are obtained from the service, using the provided me...

Created: 2009-07-04 | Last updated: 2010-12-06

Credits: Hamish McWilliam

Attributions: EBI_WU-BLAST

EBI_FASTA (1)

• Download

Run a FASTA or SSEARCH sequence similarity search using the EBI's WSFasta service (see http://www.ebi.ac.uk/Tools/webservices/services/fasta). Note: the WSFasta service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement FASTA services (REST or SOAP) should be used instead.  

Created: 2008-05-30 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI FASTA with prompts (3)

• Download

Run a FASTA analysis using the EBI’s WSFasta service (see http://www.ebi.ac.uk/Tools/webservices/services/fasta). This workflow wraps the EBI_FASTA workflow to provide a basic user interface which prompts for the required inputs: sequence, database, FASTA program and user e-mail. Other parameters (e.g. matrix, gap penalties, etc.) are allowed to default. Note: the WSFasta service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new developme...

Created: 2008-05-30 | Last updated: 2010-12-06

Credits: Hamish McWilliam

Attributions: EBI_FASTA

EBI_NCBI_BLAST (1)

• Download

Perform a BLAST search using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search (see Job_params) are allowed to default. Note: the WSNCBIBlast service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement NCBI BLA...

Created: 2008-05-31 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_NCBI_BLAST_with_prompts (1)

• Download

Run a BLAST analysis using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). This workflow wraps the EBI_NCBI_BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default. Note: the WSNCBIBlast service used by this workflow is deprecated as of 21st September 2010 and should not be use...

Created: 2008-05-31 | Last updated: 2010-12-06

Credits: Hamish McWilliam

Attributions: EBI_NCBI_BLAST

EBI_MPsrch (1)

• Download

Run a Smith-Waterman sequence search using the EBI’s WSMPsrch service (see http://www.ebi.ac.uk/Tools/webservices/services/mpsrch). Note: the WSMPsrch service used by this workflow was retired 27th January 2010. Equivalent functionality is available in the EBI's FASTA (REST or SOAP) and PSI-Search (REST or SOAP) services.  

Created: 2008-06-02 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_MAFFT (1)

• Download

Perform a multiple sequence alignment using the MAFFT tool (see http://align.bmr.kyushu-u.ac.jp/mafft/software/). The EBI's WSMafft web service (see http://www.ebi.ac.uk/Tools/webservices/services/mafft) is used to access to tool. Note: the WSMafft service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement MAFFT services (REST or SOAP) should be used instead.

Created: 2008-06-03 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_ScanPS (1)

• Download

Perform a Smith-Waterman sequence similarity search using the ScanPS tool (see http://www.compbio.dundee.ac.uk/Software/Scanps/scanps.html). In the case the EBI's WSScanPS web service (see http://www.ebi.ac.uk/Tools/webservices/services/scanps) is used to run the tool. Note: the WSScanPS service used by this workflow was retired 27th January 2010. Equivalent functionality is available in the EBI's FASTA (REST or SOAP) and PSI-Search (REST or SOAP) services.  

Created: 2008-06-03 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_MUSCLE (1)

• Download

Perform a multiple sequence alignment using the MUSCLE tool (see http://www.drive5.com/muscle/). The EBI's WSMuscle web service (see http://www.ebi.ac.uk/Tools/webservices/services/muscle) is used. Note: the WSMuscle service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement MUSCLE services (REST or SOAP) should be used instead.  

Created: 2008-06-03 | Last updated: 2010-12-06

Credits: Hamish McWilliam

EBI_TCoffee (1)

• Download

Perform a multiple sequence alignment using T-Coffee (see http://www.tcoffee.org/). The EBI's WSTCoffee web service (see http://www.ebi.ac.uk/Tools/webservices/services/tcoffee) is used. Note: the WSTCoffee service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement T-COFFEE services (REST or SOAP) should be used instead.  

Created: 2008-06-03 | Last updated: 2010-12-06

Credits: Hamish McWilliam

getInchIfromMassBankPeaklist_ChemSpider_wo... (2)

• Download

uses InChI's retrieved from a MassBank peaklist query to get compound information about those compounds via querying ChemSpider for information and displaying those results with image

Created: 2008-06-05 | Last updated: 2008-06-16

Credits: Michael Gerlich

EBI_MaxSprout (2)

• Download

Generation of protein backbone and side chain co-ordinates from a C(alpha) trace using the MaxSprout tool. The EBI's WSMaxsprout service (see http://www.ebi.ac.uk/Tools/webservices/services/maxsprout) is used to access the tool.

Created: 2008-06-05 | Last updated: 2008-06-06

Credits: Hamish McWilliam

Attributions: Structure_or_ID

Structure_or_ID (1)

• Download

Given a structure or structure entry identifer (e.g. PDB:1crn), return the structure in PDB format. If a structure identifier, in database:identifier format, is input the EBI's WSDbfetch web service (see http://www.ebi.ac.uk/Tools/webservices/services/dbfetch) is used to retrive the structure in PDB format. Otherwise the input is assumed to be a formated structure and is passed through to the output.

Created: 2008-06-06

Credits: Hamish McWilliam

Nucleotide_ORF_translation (1)

• Download

From a nucleotide sequence get the protein translations of the open reading frames (stop to stop) that are longer than a specifed minimum length. EMBOSS getorf is used to find the ORFs and perform the translations. The getorf tool is accessed via Soaplab (see http://www.ebi.ac.uk/Tools/webservices/soaplab/overview).

Created: 2008-06-06

Credits: Hamish McWilliam

Attributions: Sequence_or_ID

Fasta_string_to_fasta_list (1)

• Download

Split a string containing a set of sequences in fasta format into a list for fasta formated sequences.

Created: 2008-06-06

Credits: Hamish McWilliam

Nucleotide_InterProScan (4)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Run InterProScan using a...

Created: 2008-10-26 | Last updated: 2011-04-01

Credits: Hamish McWilliam

Attributions: EBI_InterProScan EBI_NCBI_BLAST Nucleotide_ORF_translation Fasta_string_to_fasta_list Sequence_or_ID

EBI_Blast2InterPro (2)

• Download

Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services. Perform a BLAST search a...

Created: 2008-10-26 | Last updated: 2012-08-22

Credits: Hamish McWilliam

Attributions: EBI_WU-BLAST EBI_dbfetch_fetchBatch Fasta_string_to_fasta_list EBI_InterProScan

NCBI_QBLAST (2)

• Download

Perform an NCBI BLAST sequence similarity search using NCBI's QBLAST service (see http://www.ncbi.nlm.nih.gov/BLAST/Doc/urlapi.html). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.

Created: 2008-06-07 | Last updated: 2008-06-07

Credits: Hamish McWilliam

Sequence_or_ID_or_GI (1)

• Download

Get a sequence in fasta format given one of: An NCBI GI number (e.g. 75251068). An entry identifier in database:identifier format (e.g. uniprot:Q96247). 3. A sequence entry in a format supported by EMBOSS seqret.

Created: 2008-06-07

Credits: Hamish McWilliam

Attributions: Structure_or_ID

EBI_DaliLite (1)

• Download

Pairwise structure comparison using the DaliLite tool. The EBI's WSDaliLite web service (see http://www.ebi.ac.uk/Tools/webservices/services/dalilite) is used to access the tool.

Created: 2008-06-07

Credits: Hamish McWilliam

EBI_PICR_Sequence_to_UniParc_and_InterPro (2)

• Download

Given a protein sequence get some information about it: Does this protein sequence occur in any of the protein databases (e.g. UniProtKB, PDB, etc.). Using the PICR web service (see http://www.ebi.ac.uk/Tools/picr/) map the sequence to a UniParc identifer. Which entries in the protein databases have this sequence. Using the UniParc database (see http://www.ebi.ac.uk/uniprot/database/DBDescription.html#uniparc) a summary of the databases and the entries in those databases which have this s...

Created: 2008-06-08 | Last updated: 2008-06-08

Credits: Hamish McWilliam

Attributions: EBI_dbfetch_UniParc EBI_Fetch_InterPro_Matches_UniParc EBI_PICR_Sequence_to_ID

EBI_PICR_Sequence_to_ID (1)

• Download

Map a protein sequence to the known identifiers of identical sequences. Uses the EBI's PICR web service (see http://www.ebi.ac.uk/Tools/picr/) to perform the mapping.

Created: 2008-06-08

Credits: Hamish McWilliam

EBI_dbfetch_UniParc (1)

• Download

From a list of UniParc entry identifers get the complete entries using the EBI's WSDbfetch service (see http://www.ebi.ac.uk/Tools/webservices/services/dbfetch).

Created: 2008-06-08

Credits: Hamish McWilliam

EBI_Fetch_InterPro_Matches_UniParc (1)

• Download

For a UniParc (see http://www.ebi.ac.uk/uniprot/database/DBDescription.html#uniparc) identifier/accession fetch the assocated InterPro Matches from SRS@EBI (see http://srs.ebi.ac.uk/srsbin/cgi-bin/wgetz?-page+LibInfo+-lib+IPRMC_UNIPARC).

Created: 2008-06-08

Credits: Hamish McWilliam

EBI_CENSOR (2)

• Download

The CENSOR tool identifies and masks simple and complex sequence repeats found in nucleotide and protein sequences. This workflow uses the EBI's WSCensor web service (see http://www.ebi.ac.uk/Tools/webservices/services/censor) to access the tool.

Created: 2008-06-17 | Last updated: 2008-06-25

Credits: Hamish McWilliam

tRNAscan (1)

• Download

Search a nucleotide sequence for tRNA genes using the tRNAscan-SE tool (see http://wiki.bioinformatics.org/TRNAscan-SE). This workflow uses the tRNAscan service at VBI PathPort (see http://pathport.vbi.vt.edu/services/#predict_7).

Created: 2008-06-28

Credits: Hamish McWilliam

Attributions: Sequence_or_ID_or_GI

EBI_OLS_TermInfo (1)

• Download

Get details of an ontology term given its identifer. This workflow uses the EBI's Ontology Lookup Service (OLS) to get the details of the ontology term. The OLS suports a wide range of biological and bioinformatic ontologies. See http://www.ebi.ac.uk/ontology-lookup/ for more information.

Created: 2008-07-09

Credits: Hamish McWilliam

EBI_IntAct (1)

• Download

Find protein binary interactions using the EBI's IntAct service. See http://www.ebi.ac.uk/intact/ for further details.

Created: 2008-07-09

Credits: Hamish McWilliam

Retrieve Protein Sequence (1)

• Download

Retrieves a protein sequence in Fasta format from GenBank, given a GenBank identifier. Example input for this workflow is: EDL10223.1

Created: 2008-07-30 | Last updated: 2009-12-03

Credits: Katy Wolstencroft

mustang provides structural alignment of t... (3)

• Download

This workflow experiments with the partial execution of jobs on a computational grid. The workflow elements "mustang" and "boxshade" are executed on grid nodes. Access to these resources is orchestrated with the plugin available on http://grid.inb.uni-luebeck.de. Please contact the author of this workflow for access permissions.

Created: 2008-08-20 | Last updated: 2008-08-25

Credits: Steffen Möller

Attributions: Fetch PDB flatfile from RCSB server

Retrieve Single Molecule from ZINC - struc... (1)

• Download

The ZINC database (http;//zinc.docking.org) is a collection of substances with known structures and some chemical characterisation that are commercially available. It is freely available and a much respected resource for computational screening for functional compounds. With the ZINC ID at hand, the ZINC web site is contacted and from there the URL parsed the refence to the real data. This workflow does not scale for regular docking applications. One would retrieve a collection of data inst...

Created: 2008-08-24 | Last updated: 2008-08-25

Credits: Steffen Möller

dbfetch tutorial (1)

• Download

This workflow eases entry in the world of Taverna with one of the key tasks - the retrieval of plain data. The dbfetch offers sequence and structure data from a large variety of sources. A first execution of this workflow informs about these in the "getSupportedDBs" output. Also the formats and styles are listed. The two inputs allow for the specification of a query that leaves the format with "default" (which is different for every database, "native" would be a better fit), the style is alw...

Created: 2008-09-22

Credits: Steffen Möller

runFunCUT (1)

MOBY Web Services (synchronous and asynchronous) that describe the FunCUT method. Is recommended use asynchronous MOBY services because the method needs huge range of time.   FunCUT Method Short Description: Annotates homologous sequences and includes new features related to the specific identification of protein subfamilies (orthologous groups) FunCUT (Abascal and Valencia, 2003. PROTEINS: Structure, Function, and Genetics 53:683– 692 (2003)) is application based on the study...

Created: 2008-10-03 | Last updated: 2008-10-03

Credits: José Manuel Rodríguez

Download Entries from PubChem (1)

• Download

Given a list of identifiers (e.g. CID) and their appropriate type (eID_CID - note that these differ slightly from the original identifier name -> CID <-> eID_CID), this workflow queries PubChem via PUG to retrieve a download URL for the resulting XML file containing the results. Adding support for downloading this XML file and writing it to filesystem is planned.

Created: 2009-03-30 | Last updated: 2009-03-30

Credits: Michael Gerlich

Retrieve Pathways and Compound information... (1)

• Download

Given a KEGG compound identifier (e.g. cpd:C00905), this workflow queries KEGG DB for pathways and compound information for each of these compounds. As the KEGG pathway service tries to find pathways which contain all input compounds, the input list is split up to circumvent this behaviour and to search for only one compound in a pathway at a time. Compounds identified in pathways are marked as red in the resulting pathway image.

Created: 2009-03-30 | Last updated: 2009-03-30

Credits: Michael Gerlich

Search InChI in NCBI eSearch (pccompound) (1)

• Download

This workflow takes in a search term (e.g. InChI) for search in PubChem pccompound database. The result is an xml file containing summary information about the search term and also a compound image and the compound webpage fetched from Pubchem.

Created: 2009-03-30 | Last updated: 2009-03-30

Credits: Michael Gerlich

MassBank to KEGG (1)

Workflow that queries MassBank DB to retrieve database identifiers (KEGG, PubChem, InChI) and continue search with them to retrieve pathways from KEGG for given compound identifier,searches PubChem via eutils and PUG, queries ChemSpider for compound information and image. Note: Usage of ChemSpider web services requires a valid security token - receive one by registering at ChemSpider (look at your profile to see your token)

Created: 2009-03-30 | Last updated: 2009-03-30

Credits: Michael Gerlich

Nucleotide InterProScan for the BioExtract... (3)

• Download

This workflow can be downloaded and imported into the BioExtract Server at bioextract.org. This workflow is a BioExtract Server process similar to the Nucleotide InterProScan workflow designed and implement in Taverna by Hamish McWilliams. The InterProScan tool (http://www.ebi.ac.uk/Tools/InterProScan/) searches a protein sequence against a selection of protein domain, feature and family signature databases, and integrates the results giving potential assignments to InterPro entries and Gen...

Created: 2009-04-16 | Last updated: 2009-07-01

Credits: Carol Lushbough Hamish McWilliam

Attributions: Nucleotide_InterProScan

EBI_dbfetch_fetchData (1)

• Download

Sample workflow illustrating the use of the EBI's WSDbfetch service in Triana.

Created: 2009-08-28 | Last updated: 2009-08-28

Credits: Hamish McWilliam

EBI_dbfetch_fetchBatch (1)

• Download

Sample workflow illustrating the use of EBI's WSDbfetch service with Triana.

Created: 2009-08-28

Credits: Hamish McWilliam

Fetch Dragon images from BioMoby (1)

• Download

Fetch images and annotations of snapdragons

Created: 2010-07-14 | Last updated: 2010-07-14

Credits: EdwardKawas Tomoinn

Attributions: Fetch Dragon images from BioMoby

retrieve protein sequence and do a BLAST a... (1)

• Download

retrieve protein sequence and do a BLAST and extract position from DDBJ Web services   informations on Web services available at http://xml.nig.ac.jp/index.html example accession : Q9NRA8 database : UNIPROT program : blastp  

Created: 2010-07-21 | Last updated: 2010-07-21

Credits: Lebreton

Attributions: BLAST using DDBJ service

retrieve protein sequence and do a high sp... (1)

• Download

retrieve protein sequence and do a high speed BLAST and extract position from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example accession : Q9NRA8 database : ddbjbct program : tblastn param : -b 100 -v 100

Created: 2010-07-21 | Last updated: 2010-07-21

Credits: Lebreton

retrieve protein sequence and do a BLAST w... (1)

• Download

retrieve protein sequence and do a BLAST with options from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html exxample accession : Q9NRA8 database : UNIPROT program : blastp param : -b 5 -m 7    

Created: 2010-07-21 | Last updated: 2010-09-01

Credits: Lebreton

retrieve nucleotide sequence and do a BLAS... (1)

• Download

retrieve nucleotide sequence and do a BLAST and extract position from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example : accession : AB000100 database : DDBJ program : blastn    

Created: 2010-07-21 | Last updated: 2010-07-21

Credits: Lebreton

Attributions: BLAST using DDBJ service

retrieve nucleotide sequence and do a high... (4)

• Download

retrieve nucleotide sequence and do a high speed BLAST and extract position from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example accession : AB000100 database : DDBJ program : blastn param : -b 5 -m 7

Created: 2010-07-21 | Last updated: 2010-09-07

Credits: Lebreton

retrieve nucleotide sequence and do a BLAS... (1)

• Download

retrieve nucleotide sequence and do a BLAST with options from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example accession : AB000100 database : DDBJ program : blastn param : -b 5 -m 7

Created: 2010-07-21 | Last updated: 2010-07-21

Credits: Lebreton

retrieve nucleotide sequence and do a VecS... (1)

• Download

retrieve nucleotide sequence and do a VecScreen from DDBJ Web services : A system for quickly identifying segments of a nucleic acid sequence that may be of vector origin   informations on Web services available at http://xml.nig.ac.jp/index.html accession : AB000100

Created: 2010-07-21 | Last updated: 2010-09-01

Credits: Lebreton

retrieve protein sequence and do a high sp... (1)

• Download

retrieve protein sequence and do a high speed BLAST from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example accession : Q9NRA8 database : ddbjbct program : tblastn param : -b 100 -v 100

Created: 2010-09-01 | Last updated: 2010-09-01

Credits: Lebreton

Attributions: retrieve protein sequence and do a high speed BLAST and extract position from DDBJ Web services

retrieve protein sequence and do a BLAST f... (1)

• Download

retrieve protein sequence and do a BLAST from DDBJ Web services   informations on Web services available at http://xml.nig.ac.jp/index.html example accession : Q9NRA8 database : UNIPROT program : blastp  

Created: 2010-09-01 | Last updated: 2010-09-01

Credits: Lebreton

Attributions: retrieve protein sequence and do a BLAST and extract position from DDBJ Web services

retrieve nucleotide sequence and do a high... (1)

• Download

retrieve nucleotide sequence and do a high speed BLAST from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html accession : AB000100 database : DDBJ program : blastn param : -b 5 -m 7

Created: 2010-09-01 | Last updated: 2010-09-01

Credits: Lebreton

retrieve nucleotide sequence and do a BLAS... (1)

• Download

retrieve nucleotide sequence and do a BLAST from DDBJ Web services informations on Web services available at http://xml.nig.ac.jp/index.html example : accession : AB000100 database : DDBJ program : blastn 

Created: 2010-09-01 | Last updated: 2010-09-01

Credits: Lebreton

Attributions: retrieve nucleotide sequence and do a BLAST and extract position from DDBJ Web services

NCBI BLAST (SOAP) (1)

• Download

Perform a BLAST search using the EMBL-EBI’s NCBI BLAST (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/sss/ncbi_blast_soap). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.

Created: 2010-11-29 | Last updated: 2013-03-28

Credits: Hamish McWilliam

Attributions: EBI_NCBI_BLAST NCBI BLAST (SOAP)

NCBI BLAST (SOAP) (1)

• Download

Perform a BLAST search using the EMBL-EBI’s NCBI BLAST (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/sss/ncbi_blast_soap). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.

Created: 2010-11-29 | Last updated: 2013-03-28

Attributions: EBI_NCBI_BLAST NCBI BLAST (SOAP)

InterProScan (SOAP) (1)

• Download

Perform an InterProScan search using the EMBL-EBI’s InterProScan (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap). The query sequence to use is the input, the other parameters for the search are allowed to default.

Created: 2010-12-03 | Last updated: 2013-03-28

Attributions: EBI_InterProScan

InterProScan (SOAP) (1)

• Download

Perform an InterProScan search using the EMBL-EBI’s InterProScan (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap). The query sequence to use is the input, the other parameters for the search are allowed to default.

Created: 2010-12-03 | Last updated: 2013-03-28

Credits: Hamish McWilliam

Attributions: EBI_InterProScan InterProScan (SOAP)

EMBL-EBI ClustalW2 (SOAP) (1)

• Download

Perform a ClustalW2 alignment using the EMBL-EBI’s ClustalW2 (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/msa/clustalw2_soap).

Created: 2010-12-06 | Last updated: 2013-03-28

Attributions: EBI_ClustalW2

[untitled] (1)

• Download

This workflow allows the user to search for processes that are involved with a certain gene. Using microarray-files (CEL-files), consisting of wild type and KO mice to which a stimulant is induced, the user can get an idea of the processes involved. (This is done using the global test and the literature weighted global test.) The results are then given as a text-file. Warning: workflow is not working (needs some revisions), all input is currently hardcoded! (You will have to change the file...

Created: 2011-04-26 | Last updated: 2011-04-26

Credits: Dennis Leenheer

Generate Atom Signatures of molecules give... (1)

• Download

Reference: Natural Product-likeness Score and Its Application for Prioritization of Compound Libraries Peter Ertl,* Silvio Roggo, and Ansgar Schuffenhauer Novartis Institutes for BioMedical Research, CH-4002 Basel, Switzerland http://peter-ertl.com/reprints/Ertl-JCIM-48-68-2008.pdf    The natural product likeness scorer implemented by Peter Ertl was originally devised to screen large compound libraries for natural product likeness in drug designing studies. His work is re...

Created: 2011-05-13 | Last updated: 2011-05-13

Credits: Kalai

Scoring small molecules for metabolite lik... (2)

• Download

 Prerequisite:   - CDK -Taverna Plugin 0.5.1 http://www.ts-concepts.de/cdk-taverna2/plugin/ - To run this workflow the atom_signatures file of Natural product(NP), Synthetic Molecules(SM) and query structures are needed - This could be generated from GenerateAtomSignatures.t2flow http://www.myexperiment.org/workflows/2120/download?version=1   Description of input ports : NP_file: needs precomputed Atom_signatures of desired Natural product structu...

Created: 2011-05-13 | Last updated: 2012-03-18

Credits: Kalai

Plotting distribution of natural product l... (1)

• Download

 Prerequisite:  CDK -Taverna Plugin 0.5.1 http://www.ts-concepts.de/cdk-taverna2/plugin/ - To run this workflow you need a Score file which is written to text file.  - This could be generated from ScorerActivity.t2flow http://www.myexperiment.org/workflows/2121/download?version=1   Description of input ports : score_file: Path to file name that has pre computed scores. Note: While passing file as input it could be passed as list of many files or single fi...

Created: 2011-05-13 | Last updated: 2011-05-13

Credits: Kalai

Get names of proteins similar to RNA bindi... (1)

• Download

A very simple demo workflow using some existing SADI services. It finds UniProt proteins of GO function "RNA Binding", it then runs a BLAST service to find similar UniProt proteins and then outputs their names.

Created: 2011-05-18 | Last updated: 2011-05-18

Credits: hindlem

Download Structures from PubChem given che... (1)

• Download

This workflow takes the input file containing chemical names and returns a single SDF file of structures. The names are searched against pubchem compounds via e-search. If the compound name is found an XML file containing PubChem ID is returned.The max return compound_ID is set to 1 which could be increased. If the compound name is not found then no ID is returned.  The pubchem compound_ID is then used to download structures from PubChem.  

Created: 2011-05-24 | Last updated: 2011-05-24

Credits: Kalai Michael Gerlich

Attributions: Download Entries from PubChem

NGS sample workflow with data (1)

• Download

 Sample workflow for NGS data analysis This worklfow relies on community contributions that can be installed through the following update site: http://tech.knime.org/update/community-contributions/nightly specifically the  KNIME NGS tools and the KNIME R Scripting extensions.    

Created: 2011-06-24 | Last updated: 2011-06-24

Credits: Baj

ADR-S (2)

• Download

  The ADR-S pathway seeks to establish a connection between the clinical event and the drug through different paths: (i) through proteins in common among the proteins that are drug targets or metabolite targets and proteins associated to the clinical event (ii) through proteins that are drug targets or metabolite targets and proteins associated to the clinical event that participate in a common biological pathway. The workflow proceeds as follows: First, it checks if there are pr...

Created: 2011-03-28 | Last updated: 2011-08-09

Credits: Anna Bauer-Mehren

BATWING (1)

• Download

Batwing reads in multi-locus haplotype data, and model and prior distri- bution specifications, and uses a Markov chain Monte Carlo (MCMC) method based on coalescent theory to generate approximate random samples from the posterior distributions of parameters such as mutation rates, effective population sizes and growth rates, and times of population splitting events. It also generates approximate posterior samples of the entire genealogical tree underly- ing the sample, including the tree hei...

Created: 2011-08-25 | Last updated: 2011-08-25

Credits: Pipeline

Extract Gene Sequence with Kepler (1)

• Download

This is a workflow which allows one to extract gene sequence information using the accession number as the input.  Multiple outputs include a file output of sequence header information, as well as one output window of base pair count, ratios and gene sequence.

Created: 2011-10-05 | Last updated: 2011-10-05

Credits: Wdsnellg

Match gene lists based on information in l... (7)

• Download

[THIS WORKFLOW IS IN BETA STAGE] This workflow computes the match between two lists of Entrez Gene Identifiers by means of concept profile matching (Jelier et al., van Haagen et al.). The result of this is a list of concepts ordered by their matching score (the length of the list set by maxMatchNr). Of this list the summed scores are explained by computing the concepts that contribute most to the combination of the matching genes. Example to explain (by analogy): When a group of informatic...

Created: 2012-04-17 | Last updated: 2012-04-25

Credits: Marco Roos Reinout van Schouwen Eleni Kristina Hettne BioSemantics

Attributions: Match concept profiles Explain concept scores

DatabaseID to ConceptID (7)

• Download

Purpose: This workflow maps input Identifiers, common database identifiers, to the Concept Identifiers from the EMC ontology. Result: Concept Identifiers from the EMC ontology. Comments: Database: one of CAS, DRUG, etc. The supported databases are listed below (database, description, example). CAS, Chemical Abstracts Service registry number, 64-17-5. DRUG, Drug Bank, DB00316. AF, Affymetrix, 200007_at. CHEB, ChEBI, 16236. CHID, ChemIDplus, 0000050000. EG, Entrez-Gene, 3064. GO, Gene Ontol...

Created: 2012-06-25 | Last updated: 2014-07-14

Credits: Marco Roos Martijn Schuemie Reinout van Schouwen BioSemantics

NCBI Protein Clustal Omega Alignment (1)

• Download

Searches NCBI Proteins for a given organism and protein. User VMatch (xmknr) Vmatch, a versatile software tool for efficiently solving large scale sequence matching tasks to remove possible dubplcate and clustal omega to generate a multiple sequence alignment. Clustal Omega is the latest addition to the Clustal family. It offers a significant increase in scalability over previous versions, allowing hundreds of thousands of sequences to be aligned in only a few hours. It will also make u...

Created: 2012-08-31

Credits: Carol Lushbough

Non-redundant protein alignments (1)

• Download

Execute BLASTP program to search protein databases using a protein query: Input file from iPlant Discovery Environment Save the data extract of similar sequences created by BLASTP Execute XMKNR to a compute a non-redundant set from a large collection of protein sequences. Input from the data extract created by BLASTP. Perform multiple sequence alignments using Clustal Omega and TCoffee Input from data extract created by XMKNR To execute this workflow, you need to be logged into the Bio...

Created: 2012-12-19 | Last updated: 2012-12-19

Credits: Carol Lushbough

Sequences Alignment and Sorting by Coordinate (1)

• Download

We automatically retrieve BAM filenames based on the FASTA_R1 port name We assume FASTA_R1 name to be SAMPLENAME.R1.FASTQ or SAMPLENAME.R1.fastq.gz Alignment via Burrows-Wheeler transformation using BWA-MEM algorithm Sorts the input SAM or BAM Post Alignment File Processing We automatically retrieve BAM filenames based on the FASTA_R1 port name We assume FASTA_R1 name to be SAMPLENAME.R1.FASTQ or SAMPLENAME.R1.fastq.gz MarkDuplicates examines aligned records in the supplied SAM or BAM f...

Created: 2016-05-16 | Last updated: 2016-07-06

Variant Annotation with VEP (Variant Effec... (1)

• Download

Here, from a list of g.vcf files, we execute GenotypeGVCFs command line GenotypeGVCFs perform joint genotyping on gVCF files produced by HaplotypeCaller Variant Effect Predictor http://www.ensembl.org/info/docs/tools/vep/script/index.html The VEP determines the effect of your variants (SNPs, insertions, deletions, CNVs or structural variants) on genes, transcripts, and protein sequence, as well as regulatory regions.

Created: 2016-05-16 | Last updated: 2016-07-06